PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_35310
Common NameKK1_034730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 418aa    MW: 46191.4 Da    PI: 8.3619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_35310genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-172673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++vk++G g+W+++ +  g+ R++k+c++rw ++l
    C.cajan_35310 26 KGPWTPAEDAILTEYVKKHGEGNWNSVQKNSGLFRCGKSCRLRWANHL 73
                     79******************************************9986 PP

2Myb_DNA-binding521.7e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+++++d++++lG++ W++ a+ ++ gRt++++k++w++
    C.cajan_35310  79 KGAFSPEEEQIIIDLHAKLGNK-WARMAAQLP-GRTDNEIKNFWNT 122
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7832173IPR017930Myb domain
SuperFamilySSF466898.99E-3023120IPR009057Homeodomain-like
SMARTSM007171.1E-142575IPR001005SANT/Myb domain
PfamPF002495.6E-152673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-242780IPR009057Homeodomain-like
CDDcd001671.22E-112873No hitNo description
PROSITE profilePS5129425.53674128IPR017930Myb domain
SMARTSM007171.4E-1578126IPR001005SANT/Myb domain
PfamPF002493.8E-1579122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2681127IPR009057Homeodomain-like
CDDcd001673.17E-1181122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MARTVSNNSS NDERVEDGEV RSRVRKGPWT PAEDAILTEY VKKHGEGNWN SVQKNSGLFR  60
CGKSCRLRWA NHLRPNLKKG AFSPEEEQII IDLHAKLGNK WARMAAQLPG RTDNEIKNFW  120
NTRMKRRQRA GLPLYPPEVH AEATAYHRQQ HRYIEQQPHS SPSFSLLLSS CYPKKLNDPN  180
QTHHSNANLL QNQPDAANCY INPSQQFKFS NENSGSNGNL ALPLSPLSPF GSSSSNLLNN  240
QSFAPPSASA ATDSLAPLSP QGNSGLLDAL VMEAKGLSHN DKSKSEEGST LAGKSYKRKI  300
MDYAEEEGTM SAMKKSSSGN GNPTNKSQRD DAISSSQLSK GKGVIGWDPL EEMNAMDGDL  360
VSLLNHFPLE MPMPEWYRRG ESQSLGLENQ PKASTPVPTD QESAWTLGTC WNNMPGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27261277107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149977.10.0hypothetical protein PHAVU_005G115500g
TrEMBLA0A151RML80.0A0A151RML8_CAJCA; Transcription factor GAMYB
STRINGGLYMA12G31950.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-72myb domain protein 101